BRUNOL5 antibody (70R-4933)

Rabbit polyclonal BRUNOL5 antibody raised against the middle region of BRUNOL5

Synonyms Polyclonal BRUNOL5 antibody, Anti-BRUNOL5 antibody, BRUNOL-5 antibody, Cugbp Elav-Like Family Member 5 antibody, CELF5 antibody
Specificity BRUNOL5 antibody was raised against the middle region of BRUNOL5
Cross Reactivity Human
Applications WB
Immunogen BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids AFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLP
Assay Information BRUNOL5 Blocking Peptide, catalog no. 33R-1175, is also available for use as a blocking control in assays to test for specificity of this BRUNOL5 antibody

Images

Western Blot analysis using BRUNOL5 antibody (70R-4933)

BRUNOL5 antibody (70R-4933) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BRUNOL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BRUNOL5 antibody (70R-4933) | BRUNOL5 antibody (70R-4933) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors