BRUNOL6 antibody (70R-4726)

Rabbit polyclonal BRUNOL6 antibody

Synonyms Polyclonal BRUNOL6 antibody, Anti-BRUNOL6 antibody, CELF6 antibody, Bruno-Like 6 Rna Binding Protein antibody
Cross Reactivity Human
Applications WB
Immunogen BRUNOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids QAALLAAAQGPGLGPVAAVAAQMQHVAAFSLVAAPLLPAAAANSPPGSGP
Assay Information BRUNOL6 Blocking Peptide, catalog no. 33R-7452, is also available for use as a blocking control in assays to test for specificity of this BRUNOL6 antibody


Western Blot analysis using BRUNOL6 antibody (70R-4726)

BRUNOL6 antibody (70R-4726) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BRUNOL6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BRUNOL6 is a RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. It mediates exon inclusion and/or exclusion in pre-mRNAs that are subject to tissue-specific and developmentally regulated alternative splicing. BRUNOL6 specifically activates exon 5 inclusion of TNNT2 in a muscle-specific splicing enhancer (MSE)-dependent manner. It also promotes exon exclusion of INSR pre-mRNA.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BRUNOL6 antibody (70R-4726) | BRUNOL6 antibody (70R-4726) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors