BTBD10 antibody (70R-5084)

Rabbit polyclonal BTBD10 antibody

Synonyms Polyclonal BTBD10 antibody, Anti-BTBD10 antibody, GMRP-1 antibody, Btb POZ domain containing 10 antibody, Poz Domain Containing 10 antibody, GMRP1 antibody, MGC13007 antibody
Cross Reactivity Human
Applications WB
Immunogen BTBD10 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL
Assay Information BTBD10 Blocking Peptide, catalog no. 33R-1218, is also available for use as a blocking control in assays to test for specificity of this BTBD10 antibody

Images

Western Blot analysis using BTBD10 antibody (70R-5084)

BTBD10 antibody (70R-5084) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BTBD10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BTBD10 appears to behave as a suppressor of cell death including neuronal cell death related to amyotrophic lateral sclerosis and an enhancer of cell growth via its positive regulation of Akt phosphorylation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BTBD10 antibody (70R-5084) | BTBD10 antibody (70R-5084) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors