BTG4 antibody (70R-5595)

Rabbit polyclonal BTG4 antibody raised against the middle region of BTG4

Synonyms Polyclonal BTG4 antibody, Anti-BTG4 antibody, MGC33003 antibody, B-Cell Translocation Gene 4 antibody, PC3B antibody
Specificity BTG4 antibody was raised against the middle region of BTG4
Cross Reactivity Human
Applications WB
Immunogen BTG4 antibody was raised using the middle region of BTG4 corresponding to a region with amino acids ILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGR
Assay Information BTG4 Blocking Peptide, catalog no. 33R-4043, is also available for use as a blocking control in assays to test for specificity of this BTG4 antibody


Western Blot analysis using BTG4 antibody (70R-5595)

BTG4 antibody (70R-5595) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BTG4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BTG4 antibody (70R-5595) | BTG4 antibody (70R-5595) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors