BTN1A1 antibody (70R-7235)

Rabbit polyclonal BTN1A1 antibody raised against the N terminal of BTN1A1

Synonyms Polyclonal BTN1A1 antibody, Anti-BTN1A1 antibody, Butyrophilin Subfamily 1 Member A1 antibody, BT antibody, BTN antibody
Specificity BTN1A1 antibody was raised against the N terminal of BTN1A1
Cross Reactivity Human
Applications WB
Immunogen BTN1A1 antibody was raised using the N terminal of BTN1A1 corresponding to a region with amino acids LPCRLSPNASAEHLELRWFRKKVSPAVLVHRDGREQEAEQMPEYRGRATL
Assay Information BTN1A1 Blocking Peptide, catalog no. 33R-5259, is also available for use as a blocking control in assays to test for specificity of this BTN1A1 antibody

Images

Western Blot analysis using BTN1A1 antibody (70R-7235)

BTN1A1 antibody (70R-7235) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BTN1A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.Butyrophilin is the major protein associated with fat droplets in the milk. It is a member of the immunoglobulin superfamily. It may have a cell surface receptor function. The human butyrophilin gene is localized in the major histocompatibility complex (MHC) class I region of 6p and may have arisen relatively recently in evolution by the shuffling of exons between 2 ancestral gene families.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BTN1A1 antibody (70R-7235) | BTN1A1 antibody (70R-7235) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors