BTN2A1 antibody (70R-7238)

Rabbit polyclonal BTN2A1 antibody raised against the N terminal of BTN2A1

Synonyms Polyclonal BTN2A1 antibody, Anti-BTN2A1 antibody, Butyrophilin Subfamily 2 Member A1 antibody, DJ3E1.1 antibody, FLJ36567 antibody, BTF1 antibody, BT2.1 antibody, BK14H9.1 antibody
Specificity BTN2A1 antibody was raised against the N terminal of BTN2A1
Cross Reactivity Human
Applications WB
Immunogen BTN2A1 antibody was raised using the N terminal of BTN2A1 corresponding to a region with amino acids SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH
Assay Information BTN2A1 Blocking Peptide, catalog no. 33R-8900, is also available for use as a blocking control in assays to test for specificity of this BTN2A1 antibody

Images

Western Blot analysis using BTN2A1 antibody (70R-7238)

BTN2A1 antibody (70R-7238) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BTN2A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin geneuperfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BTN2A1 antibody (70R-7238) | BTN2A1 antibody (70R-7238) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors