BTNL9 antibody (70R-7019)

Rabbit polyclonal BTNL9 antibody raised against the N terminal of BTNL9

Synonyms Polyclonal BTNL9 antibody, Anti-BTNL9 antibody, BTN3 antibody, VDLS1900 antibody, Butyrophilin-Like 9 antibody
Specificity BTNL9 antibody was raised against the N terminal of BTNL9
Cross Reactivity Human
Applications WB
Immunogen BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL
Assay Information BTNL9 Blocking Peptide, catalog no. 33R-2485, is also available for use as a blocking control in assays to test for specificity of this BTNL9 antibody

Images

Western Blot analysis using BTNL9 antibody (70R-7019)

BTNL9 antibody (70R-7019) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BTNL9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of BTNL9 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BTNL9 antibody (70R-7019) | BTNL9 antibody (70R-7019) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors