BVES antibody (70R-6558)

Rabbit polyclonal BVES antibody raised against the middle region of BVES

Synonyms Polyclonal BVES antibody, Anti-BVES antibody, POPDC1 antibody, HBVES antibody, MGC42413 antibody, Blood Vessel Epicardial Substance antibody, POP1 antibody
Specificity BVES antibody was raised against the middle region of BVES
Cross Reactivity Human
Applications WB
Immunogen BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS
Assay Information BVES Blocking Peptide, catalog no. 33R-10170, is also available for use as a blocking control in assays to test for specificity of this BVES antibody

Images

Western Blot analysis using BVES antibody (70R-6558)

BVES antibody (70R-6558) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BVES antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the POP family of proteins containing three putative transmembrane domains. This gene is expressed in cardiac and skeletal muscle and may play an important role in development of these tissues. The mouse ortholog may be involved in the regeneration of adult skeletal muscle and may act as a cell adhesion molecule in coronary vasculogenesis. Two transcript variants encoding the same protein have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BVES antibody (70R-6558) | BVES antibody (70R-6558) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors