BXDC2 antibody (70R-3417)

Rabbit polyclonal BXDC2 antibody raised against the middle region of Bxdc2

Synonyms Polyclonal BXDC2 antibody, Anti-BXDC2 antibody, FLJ11100 antibody, BRIX antibody
Specificity BXDC2 antibody was raised against the middle region of Bxdc2
Cross Reactivity Human
Applications WB
Immunogen BXDC2 antibody was raised using the middle region of Bxdc2 corresponding to a region with amino acids ALLKELLIQIFSTPRYHPKSQPFVDHVFTFTILDNRIWFRNFQIIEEDAA
Assay Information BXDC2 Blocking Peptide, catalog no. 33R-1351, is also available for use as a blocking control in assays to test for specificity of this BXDC2 antibody


Western Blot analysis using BXDC2 antibody (70R-3417)

BXDC2 antibody (70R-3417) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BXDC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BXDC2 is required for biogenesis of the 60S ribosomal subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BXDC2 antibody (70R-3417) | BXDC2 antibody (70R-3417) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors