BXDC5 antibody (70R-4968)

Rabbit polyclonal BXDC5 antibody raised against the N terminal of BXDC5

Synonyms Polyclonal BXDC5 antibody, Anti-BXDC5 antibody, RP11-118B23.1 antibody, DKFZp761M0215 antibody, DKFZp761G0415 antibody, FLJ12475 antibody, Brix Domain Containing 5 antibody, RPF1 antibody
Specificity BXDC5 antibody was raised against the N terminal of BXDC5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGD
Assay Information BXDC5 Blocking Peptide, catalog no. 33R-1004, is also available for use as a blocking control in assays to test for specificity of this BXDC5 antibody


Western Blot analysis using BXDC5 antibody (70R-4968)

BXDC5 antibody (70R-4968) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BXDC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BXDC5 may be required for ribosome biogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BXDC5 antibody (70R-4968) | BXDC5 antibody (70R-4968) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors