C10ORF56 antibody (70R-3372)

Rabbit polyclonal C10ORF56 antibody raised against the middle region of C10Orf56

Synonyms Polyclonal C10ORF56 antibody, Anti-C10ORF56 antibody, Chromosome ORF-10, Chromosome ORF 10 antibody, Chromosome ORF-10 antibody, Chromosome ORF 10, Chromosome 10 ORF, FLJ90798 antibody
Specificity C10ORF56 antibody was raised against the middle region of C10Orf56
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C10ORF56 antibody was raised using the middle region of C10Orf56 corresponding to a region with amino acids LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL
Assay Information C10ORF56 Blocking Peptide, catalog no. 33R-5470, is also available for use as a blocking control in assays to test for specificity of this C10ORF56 antibody


Western Blot analysis using C10ORF56 antibody (70R-3372)

C10ORF56 antibody (70R-3372) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C10ORF56 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C10orf56 is probably involved in oxidoreductase activity.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C10ORF56 antibody (70R-3372) | C10ORF56 antibody (70R-3372) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors