C10ORF96 antibody (70R-3232)

Rabbit polyclonal C10ORF96 antibody raised against the middle region of C10Orf96

Synonyms Polyclonal C10ORF96 antibody, Anti-C10ORF96 antibody, Chromosome ORF 10 antibody, Chromosome ORF-10 antibody, Chromosome ORF-10, Chromosome ORF 10, Chromosome 10 ORF, MGC35062 antibody
Specificity C10ORF96 antibody was raised against the middle region of C10Orf96
Cross Reactivity Human
Applications WB
Immunogen C10ORF96 antibody was raised using the middle region of C10Orf96 corresponding to a region with amino acids QANMLKSEMKSMEHDSSQLNELQKQKSELIQELFTLQRKLKVFEDEENES
Assay Information C10ORF96 Blocking Peptide, catalog no. 33R-7472, is also available for use as a blocking control in assays to test for specificity of this C10ORF96 antibody


Western Blot analysis using C10ORF96 antibody (70R-3232)

C10ORF96 antibody (70R-3232) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C10ORF96 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C10ORF96 antibody (70R-3232) | C10ORF96 antibody (70R-3232) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors