C12ORF24 antibody (70R-3636)

Rabbit polyclonal C12ORF24 antibody raised against the N terminal Of C12Orf24

Synonyms Polyclonal C12ORF24 antibody, Anti-C12ORF24 antibody, Chromosome ORF 12, Chromosome ORF-12 antibody, Chromosome ORF-12, HSU79274 antibody, Chromosome 12 ORF, Chromosome ORF 12 antibody
Specificity C12ORF24 antibody was raised against the N terminal Of C12Orf24
Cross Reactivity Human
Applications WB
Immunogen C12ORF24 antibody was raised using the N terminal Of C12Orf24 corresponding to a region with amino acids AVAGTEGGGGGSAGYSCYQNSKGSDRIKDGYKVNSHIAKLQELWKTPQNQ
Assay Information C12ORF24 Blocking Peptide, catalog no. 33R-1583, is also available for use as a blocking control in assays to test for specificity of this C12ORF24 antibody

Images

Western Blot analysis using C12ORF24 antibody (70R-3636)

C12ORF24 antibody (70R-3636) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C12ORF24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C12orf24 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C12ORF24 antibody (70R-3636) | C12ORF24 antibody (70R-3636) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors