C12ORF4 antibody (70R-3498)

Rabbit polyclonal C12ORF4 antibody raised against the middle region of C12Orf4

Synonyms Polyclonal C12ORF4 antibody, Anti-C12ORF4 antibody, Chromosome ORF 12, Chromosome ORF 12 antibody, Chromosome ORF-12 antibody, Chromosome 12 ORF, FLJ23899 antibody, Chromosome ORF-12, FLJ21158 antibody
Specificity C12ORF4 antibody was raised against the middle region of C12Orf4
Cross Reactivity Human
Applications WB
Immunogen C12ORF4 antibody was raised using the middle region of C12Orf4 corresponding to a region with amino acids QELGKSLTDQDVNSLAAQHFESQQDLENKWSNELKQSTAIQKQEYQEWVI
Assay Information C12ORF4 Blocking Peptide, catalog no. 33R-7530, is also available for use as a blocking control in assays to test for specificity of this C12ORF4 antibody


Western Blot analysis using C12ORF4 antibody (70R-3498)

C12ORF4 antibody (70R-3498) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C12ORF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 12 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C12ORF4 antibody (70R-3498) | C12ORF4 antibody (70R-3498) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors