C12ORF49 antibody (70R-7355)

Rabbit polyclonal C12ORF49 antibody raised against the C terminal Of C12Orf49

Synonyms Polyclonal C12ORF49 antibody, Anti-C12ORF49 antibody, Chromosome ORF-12 antibody, Chromosome 12 ORF, Chromosome ORF 12, Chromosome ORF 12 antibody, FLJ21415 antibody, Chromosome ORF-12
Specificity C12ORF49 antibody was raised against the C terminal Of C12Orf49
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C12ORF49 antibody was raised using the C terminal Of C12Orf49 corresponding to a region with amino acids LERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKY
Assay Information C12ORF49 Blocking Peptide, catalog no. 33R-4924, is also available for use as a blocking control in assays to test for specificity of this C12ORF49 antibody


Western Blot analysis using C12ORF49 antibody (70R-7355)

C12ORF49 antibody (70R-7355) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C12ORF49 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C12orf49 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C12ORF49 antibody (70R-7355) | C12ORF49 antibody (70R-7355) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors