C14ORF130 antibody (70R-1154)

Rabbit polyclonal C14ORF130 antibody raised against the C terminal Of C14Orf130

Synonyms Polyclonal C14ORF130 antibody, Anti-C14ORF130 antibody, Chromosome ORF 14, Chromosome 14 ORF, FLJ10483 antibody, Chromosome ORF-14, Chromosome ORF 14 antibody, Chromosome ORF-14 antibody, MGC9518 antibody
Specificity C14ORF130 antibody was raised against the C terminal Of C14Orf130
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen C14ORF130 antibody was raised using the C terminal Of C14Orf130 corresponding to a region with amino acids DRSDPLMDTLSSMNRVQQVELICEYNDLKTELKDYLKRFADEGTVVKRED
Assay Information C14ORF130 Blocking Peptide, catalog no. 33R-2148, is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody


Immunohistochemical staining using C14ORF130 antibody (70R-1154)

C14ORF130 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C14ORF130 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using C14ORF130 antibody (70R-1154) | C14ORF130 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using C14ORF130 antibody (70R-1154) | C14ORF130 antibody (70R-1154) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors