C14ORF130 antibody (70R-2272)

Rabbit polyclonal C14ORF130 antibody raised against the N terminal Of C14Orf130

Synonyms Polyclonal C14ORF130 antibody, Anti-C14ORF130 antibody, MGC9518 antibody, Chromosome ORF-14, Chromosome 14 ORF, FLJ10483 antibody, Chromosome ORF 14 antibody, Chromosome ORF 14, Chromosome ORF-14 antibody
Specificity C14ORF130 antibody was raised against the N terminal Of C14Orf130
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C14ORF130 antibody was raised using the N terminal Of C14Orf130 corresponding to a region with amino acids MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ
Assay Information C14ORF130 Blocking Peptide, catalog no. 33R-5657, is also available for use as a blocking control in assays to test for specificity of this C14ORF130 antibody

Images

Western Blot analysis using C14ORF130 antibody (70R-2272)

C14ORF130 antibody (70R-2272) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF130 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C14ORF130 is an E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. C14ORF130 recognises and binds to proteins bearing specific amino-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C14ORF130 antibody (70R-2272) | C14ORF130 antibody (70R-2272) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors