C14ORF140 antibody (70R-3954)

Rabbit polyclonal C14ORF140 antibody raised against the N terminal Of C14Orf140

Synonyms Polyclonal C14ORF140 antibody, Anti-C14ORF140 antibody, Chromosome ORF-14, Chromosome ORF-14 antibody, Chromosome ORF 14 antibody, Chromosome ORF 14, FLJ23093 antibody, Chromosome 14 ORF
Specificity C14ORF140 antibody was raised against the N terminal Of C14Orf140
Cross Reactivity Human
Applications WB
Immunogen C14ORF140 antibody was raised using the N terminal Of C14Orf140 corresponding to a region with amino acids QQDPESDSQGQGNGLFYSSGPQSWYPKANNQDFIPFTKKRVGVDRAFPLK
Assay Information C14ORF140 Blocking Peptide, catalog no. 33R-7690, is also available for use as a blocking control in assays to test for specificity of this C14ORF140 antibody

Images

Western Blot analysis using C14ORF140 antibody (70R-3954)

C14ORF140 antibody (70R-3954) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF140 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C14orf140 belongs to the UPF0418 family. The exact function of C14orf140 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C14ORF140 antibody (70R-3954) | C14ORF140 antibody (70R-3954) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors