C14ORF148 antibody (70R-3453)

Rabbit polyclonal C14ORF148 antibody raised against the middle region of C14Orf148

Synonyms Polyclonal C14ORF148 antibody, Anti-C14ORF148 antibody, Chromosome ORF 14 antibody, Chromosome 14 ORF, FLJ32809 antibody, Chromosome ORF 14, Chromosome ORF-14 antibody, Chromosome ORF-14
Specificity C14ORF148 antibody was raised against the middle region of C14Orf148
Cross Reactivity Human
Applications WB
Immunogen C14ORF148 antibody was raised using the middle region of C14Orf148 corresponding to a region with amino acids KLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATCPYSPAG
Assay Information C14ORF148 Blocking Peptide, catalog no. 33R-4517, is also available for use as a blocking control in assays to test for specificity of this C14ORF148 antibody


Western Blot analysis using C14ORF148 antibody (70R-3453)

C14ORF148 antibody (70R-3453) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF148 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C14Orf148 probably functions an an oxidoreductase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C14ORF148 antibody (70R-3453) | C14ORF148 antibody (70R-3453) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors