C14ORF156 antibody (70R-4685)

Rabbit polyclonal C14ORF156 antibody raised against the N terminal Of C14Orf156

Synonyms Polyclonal C14ORF156 antibody, Anti-C14ORF156 antibody, Chromosome ORF 14, Chromosome ORF-14, Chromosome ORF 14 antibody, Chromosome ORF-14 antibody, Chromosome 14 ORF
Specificity C14ORF156 antibody was raised against the N terminal Of C14Orf156
Cross Reactivity Human
Applications WB
Immunogen C14ORF156 antibody was raised using the N terminal Of C14Orf156 corresponding to a region with amino acids PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
Assay Information C14ORF156 Blocking Peptide, catalog no. 33R-7071, is also available for use as a blocking control in assays to test for specificity of this C14ORF156 antibody

Images

Western Blot analysis using C14ORF156 antibody (70R-4685)

C14ORF156 antibody (70R-4685) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF156 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C14ORF156 antibody (70R-4685) | C14ORF156 antibody (70R-4685) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors