C14ORF37 antibody (70R-6640)

Rabbit polyclonal C14ORF37 antibody raised against the N terminal Of C14Orf37

Synonyms Polyclonal C14ORF37 antibody, Anti-C14ORF37 antibody, Chromosome ORF-14 antibody, Chromosome ORF 14 antibody, c14_5376 antibody, Chromosome ORF-14, Chromosome ORF 14, Chromosome 14 ORF
Specificity C14ORF37 antibody was raised against the N terminal Of C14Orf37
Cross Reactivity Human
Applications WB
Immunogen C14ORF37 antibody was raised using the N terminal Of C14Orf37 corresponding to a region with amino acids EIAHVHAEKGQSDKMNTDDLENSSVTSKQTPQLVVSEDPMMMSAVPSATS
Assay Information C14ORF37 Blocking Peptide, catalog no. 33R-2462, is also available for use as a blocking control in assays to test for specificity of this C14ORF37 antibody

Images

Western Blot analysis using C14ORF37 antibody (70R-6640)

C14ORF37 antibody (70R-6640) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 84 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C14ORF37 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 14 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C14ORF37 antibody (70R-6640) | C14ORF37 antibody (70R-6640) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors