C16ORF46 antibody (70R-4158)

Rabbit polyclonal C16ORF46 antibody raised against the N terminal Of C16Orf46

Synonyms Polyclonal C16ORF46 antibody, Anti-C16ORF46 antibody, Chromosome ORF-16 antibody, FLJ32702 antibody, Chromosome ORF 16 antibody, Chromosome ORF 16, Chromosome 16 ORF, Chromosome ORF-16
Specificity C16ORF46 antibody was raised against the N terminal Of C16Orf46
Cross Reactivity Human
Applications WB
Immunogen C16ORF46 antibody was raised using the N terminal Of C16Orf46 corresponding to a region with amino acids LSHWSLQTKPPTEGGPEKDQSSPSQTQAAPQGPSTASRAISDICFPTYFR
Assay Information C16ORF46 Blocking Peptide, catalog no. 33R-5431, is also available for use as a blocking control in assays to test for specificity of this C16ORF46 antibody


Western Blot analysis using C16ORF46 antibody (70R-4158)

C16ORF46 antibody (70R-4158) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C16ORF46 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C16orf46 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C16ORF46 antibody (70R-4158) | C16ORF46 antibody (70R-4158) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors