C16ORF61 antibody (70R-3515)

Rabbit polyclonal C16ORF61 antibody raised against the middle region of C16Orf61

Synonyms Polyclonal C16ORF61 antibody, Anti-C16ORF61 antibody, Chromosome ORF 16, 2310061C15Rik antibody, Chromosome ORF-16 antibody, Chromosome 16 ORF, DC13 antibody, Chromosome ORF 16 antibody, Chromosome ORF-16
Specificity C16ORF61 antibody was raised against the middle region of C16Orf61
Cross Reactivity Human
Applications WB
Immunogen C16ORF61 antibody was raised using the middle region of C16Orf61 corresponding to a region with amino acids NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE
Assay Information C16ORF61 Blocking Peptide, catalog no. 33R-6726, is also available for use as a blocking control in assays to test for specificity of this C16ORF61 antibody

Images

Western Blot analysis using C16ORF61 antibody (70R-3515)

C16ORF61 antibody (70R-3515) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 9 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C16ORF61 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C16ORF61 antibody (70R-3515) | C16ORF61 antibody (70R-3515) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors