C16ORF65 antibody (70R-4265)

Rabbit polyclonal C16ORF65 antibody raised against the middle region of C16Orf65

Synonyms Polyclonal C16ORF65 antibody, Anti-C16ORF65 antibody, Chromosome 16 ORF, Chromosome ORF-16 antibody, Chromosome ORF 16 antibody, MGC50721 antibody, Chromosome ORF-16, Chromosome ORF 16
Specificity C16ORF65 antibody was raised against the middle region of C16Orf65
Cross Reactivity Human
Applications WB
Immunogen C16ORF65 antibody was raised using the middle region of C16Orf65 corresponding to a region with amino acids TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI
Assay Information C16ORF65 Blocking Peptide, catalog no. 33R-9303, is also available for use as a blocking control in assays to test for specificity of this C16ORF65 antibody

Images

Western Blot analysis using C16ORF65 antibody (70R-4265)

C16ORF65 antibody (70R-4265) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C16ORF65 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 16 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C16ORF65 antibody (70R-4265) | C16ORF65 antibody (70R-4265) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors