C17ORF48 antibody (70R-4091)

Rabbit polyclonal C17ORF48 antibody raised against the middle region of C17Orf48

Synonyms Polyclonal C17ORF48 antibody, Anti-C17ORF48 antibody, Chromosome ORF 17, NBLA03831 antibody, Chromosome ORF-17, Chromosome 17 ORF, MDS006 antibody, Chromosome ORF-17 antibody, Chromosome ORF 17 antibody
Specificity C17ORF48 antibody was raised against the middle region of C17Orf48
Cross Reactivity Human
Applications WB
Immunogen C17ORF48 antibody was raised using the middle region of C17Orf48 corresponding to a region with amino acids KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF
Assay Information C17ORF48 Blocking Peptide, catalog no. 33R-4738, is also available for use as a blocking control in assays to test for specificity of this C17ORF48 antibody

Images

Western Blot analysis using C17ORF48 antibody (70R-4091)

C17ORF48 antibody (70R-4091) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C17ORF48 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The C17ORF48 protein hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C17ORF48 antibody (70R-4091) | C17ORF48 antibody (70R-4091) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors