C17ORF64 antibody (70R-3321)

Rabbit polyclonal C17ORF64 antibody raised against the middle region of C17Orf64

Synonyms Polyclonal C17ORF64 antibody, Anti-C17ORF64 antibody, Chromosome ORF-17, Chromosome ORF 17, Chromosome ORF 17 antibody, Chromosome 17 ORF, Chromosome ORF-17 antibody
Specificity C17ORF64 antibody was raised against the middle region of C17Orf64
Cross Reactivity Human
Applications WB
Immunogen C17ORF64 antibody was raised using the middle region of C17Orf64 corresponding to a region with amino acids NMQTPGQGSPLPGQPRSQDHVKKDSLRELSQKPKLKRKRIKEAPETPETE
Assay Information C17ORF64 Blocking Peptide, catalog no. 33R-6799, is also available for use as a blocking control in assays to test for specificity of this C17ORF64 antibody


Western Blot analysis using C17ORF64 antibody (70R-3321)

C17ORF64 antibody (70R-3321) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C17ORF64 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 17 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C17ORF64 antibody (70R-3321) | C17ORF64 antibody (70R-3321) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors