C17orf75 antibody (70R-4017)

Rabbit polyclonal C17orf75 antibody raised against the middle region of C17orf75

Synonyms Polyclonal C17orf75 antibody, Anti-C17orf75 antibody, Chromosome ORF 17, Chromosome ORF-17, Chromosome 17 Open Reading Frame 75 antibody, Chromosome ORF 17 antibody, NJMU-R1 antibody, Chromosome 17 ORF, Chromosome ORF-17 antibody
Specificity C17orf75 antibody was raised against the middle region of C17orf75
Cross Reactivity Human
Applications WB
Immunogen C17orf75 antibody was raised using the middle region of C17orf75 corresponding to a region with amino acids KLKAIQDTNNLKRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHE
Assay Information C17orf75 Blocking Peptide, catalog no. 33R-4513, is also available for use as a blocking control in assays to test for specificity of this C17orf75 antibody


Western Blot analysis using C17orf75 antibody (70R-4017)

C17orf75 antibody (70R-4017) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C17orf75 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The C17orf75 may have a role in spermatogenesis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C17orf75 antibody (70R-4017) | C17orf75 antibody (70R-4017) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors