C17ORF78 antibody (70R-7006)

Rabbit polyclonal C17ORF78 antibody raised against the middle region of C17Orf78

Synonyms Polyclonal C17ORF78 antibody, Anti-C17ORF78 antibody, Chromosome ORF-17, Chromosome ORF 17, MGC34759 antibody, Chromosome 17 ORF, FLJ39647 antibody, Chromosome ORF-17 antibody, Chromosome ORF 17 antibody
Specificity C17ORF78 antibody was raised against the middle region of C17Orf78
Cross Reactivity Human
Applications WB
Immunogen C17ORF78 antibody was raised using the middle region of C17Orf78 corresponding to a region with amino acids LGARKLCQCQWLWRWQKKGGQPPGTAESKPDSQPQKVGQDAANSSNPKKA
Assay Information C17ORF78 Blocking Peptide, catalog no. 33R-4963, is also available for use as a blocking control in assays to test for specificity of this C17ORF78 antibody

Images

Western Blot analysis using C17ORF78 antibody (70R-7006)

C17ORF78 antibody (70R-7006) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C17ORF78 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The exact function of the protein encoded by this gene is not known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C17ORF78 antibody (70R-7006) | C17ORF78 antibody (70R-7006) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors