C18ORF10 antibody (70R-4241)

Rabbit polyclonal C18ORF10 antibody raised against the middle region of C18Orf10

Synonyms Polyclonal C18ORF10 antibody, Anti-C18ORF10 antibody, Chromosome 18 ORF, Chromosome ORF-18 antibody, Chromosome ORF-18, HsT3006 antibody, Chromosome ORF 18, DKFZP586M1523 antibody, Chromosome ORF 18 antibody, HMFN0601 antibody, L17 antibody
Specificity C18ORF10 antibody was raised against the middle region of C18Orf10
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C18ORF10 antibody was raised using the middle region of C18Orf10 corresponding to a region with amino acids LYWHFLTDTFTAYYRLLITHLGLPQWQYAFTSYGISPQAKQWFSMYKPIT
Assay Information C18ORF10 Blocking Peptide, catalog no. 33R-5577, is also available for use as a blocking control in assays to test for specificity of this C18ORF10 antibody


Western Blot analysis using C18ORF10 antibody (70R-4241)

C18ORF10 antibody (70R-4241) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C18ORF10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C18orf10 has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C18ORF10 antibody (70R-4241) | C18ORF10 antibody (70R-4241) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors