C19ORF15 antibody (70R-6904)

Rabbit polyclonal C19ORF15 antibody raised against the C terminal Of C19Orf15

Synonyms Polyclonal C19ORF15 antibody, Anti-C19ORF15 antibody, Chromosome 19 ORF, Chromosome ORF-19 antibody, FLJ46353 antibody, FLJ38899 antibody, Chromosome ORF-19, Chromosome ORF 19, MGC125664 antibody, Chromosome ORF 19 antibody, DKFZP434A1022 antibody
Specificity C19ORF15 antibody was raised against the C terminal Of C19Orf15
Cross Reactivity Human
Applications WB
Immunogen C19ORF15 antibody was raised using the C terminal Of C19Orf15 corresponding to a region with amino acids FFLIQDLVTGDSGSFQGSYVLLVVGGGPTLDSLKDYSEDEIYRFNSPLDK
Assay Information C19ORF15 Blocking Peptide, catalog no. 33R-2894, is also available for use as a blocking control in assays to test for specificity of this C19ORF15 antibody

Images

Western Blot analysis using C19ORF15 antibody (70R-6904)

C19ORF15 antibody (70R-6904) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 92 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C19orf15 is a single-pass type I membrane protein. The exact function of C19orf15 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C19ORF15 antibody (70R-6904) | C19ORF15 antibody (70R-6904) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors