C19orf18 antibody (70R-4541)

Rabbit polyclonal C19orf18 antibody raised against the N terminal of C19orf18

Synonyms Polyclonal C19orf18 antibody, Anti-C19orf18 antibody, Chromosome ORF 19 antibody, Chromosome 19 ORF, MGC41906 antibody, Chromosome ORF-19, Chromosome ORF 19, Chromosome ORF-19 antibody, Chromosome 19 Open Reading Frame 18 antibody
Specificity C19orf18 antibody was raised against the N terminal of C19orf18
Cross Reactivity Human
Applications WB
Immunogen C19orf18 antibody was raised using the N terminal of C19orf18 corresponding to a region with amino acids NITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMK
Assay Information C19orf18 Blocking Peptide, catalog no. 33R-6735, is also available for use as a blocking control in assays to test for specificity of this C19orf18 antibody

Images

Western Blot analysis using C19orf18 antibody (70R-4541)

C19orf18 antibody (70R-4541) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 24 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19orf18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 19 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C19orf18 antibody (70R-4541) | C19orf18 antibody (70R-4541) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors