C19ORF24 antibody (70R-4955)

Rabbit polyclonal C19ORF24 antibody raised against the N terminal Of C19Orf24

Synonyms Polyclonal C19ORF24 antibody, Anti-C19ORF24 antibody, FLJ20640 antibody, Chromosome ORF 19, Chromosome ORF-19, Chromosome ORF 19 antibody, Chromosome ORF-19 antibody, Chromosome 19 ORF
Specificity C19ORF24 antibody was raised against the N terminal Of C19Orf24
Cross Reactivity Human
Applications WB
Immunogen C19ORF24 antibody was raised using the N terminal Of C19Orf24 corresponding to a region with amino acids MREGQEMGPTPVPSNPLLHRSFPCWPRGWSHPVPTRELLLEPAQPADLLP
Assay Information C19ORF24 Blocking Peptide, catalog no. 33R-6357, is also available for use as a blocking control in assays to test for specificity of this C19ORF24 antibody

Images

Western Blot analysis using C19ORF24 antibody (70R-4955)

C19ORF24 antibody (70R-4955) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 14 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C19orf24 is a novel human non-classical secreted protein which is encoded by the hypothetical gene C19orf24 (chromosome 19 open reading frame 24). The exact function of C19orf24 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C19ORF24 antibody (70R-4955) | C19ORF24 antibody (70R-4955) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors