C19ORF28 antibody (70R-6748)

Rabbit polyclonal C19ORF28 antibody raised against the N terminal Of C19Orf28

Synonyms Polyclonal C19ORF28 antibody, Anti-C19ORF28 antibody, Chromosome ORF 19 antibody, Chromosome ORF 19, Chromosome 19 ORF, MGC20700 antibody, PP3501 antibody, Chromosome ORF-19, Chromosome ORF-19 antibody
Specificity C19ORF28 antibody was raised against the N terminal Of C19Orf28
Cross Reactivity Human
Applications WB
Immunogen C19ORF28 antibody was raised using the N terminal Of C19Orf28 corresponding to a region with amino acids MGPGPPAAGAAPSPRPLSLVARLSYAVGHFLNDLCASMWFTYLLLYLHSV
Assay Information C19ORF28 Blocking Peptide, catalog no. 33R-6054, is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody

Images

Western Blot analysis using C19ORF28 antibody (70R-6748)

C19ORF28 antibody (70R-6748) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The C19ORF28 protein may be involved in transmembrane transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C19ORF28 antibody (70R-6748) | C19ORF28 antibody (70R-6748) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors