C19ORF28 antibody (70R-6785)

Rabbit polyclonal C19ORF28 antibody raised against the middle region of C19Orf28

Synonyms Polyclonal C19ORF28 antibody, Anti-C19ORF28 antibody, MGC20700 antibody, PP3501 antibody, Chromosome ORF 19 antibody, Chromosome ORF-19 antibody, Chromosome ORF-19, Chromosome 19 ORF, Chromosome ORF 19
Specificity C19ORF28 antibody was raised against the middle region of C19Orf28
Cross Reactivity Human
Applications IHC, WB
Immunogen C19ORF28 antibody was raised using the middle region of C19Orf28 corresponding to a region with amino acids VELTALRYAFTVVANITVYGAAWLLLHLQGSSRVEPTQDISISDQLGGQD
Assay Information C19ORF28 Blocking Peptide, catalog no. 33R-9502, is also available for use as a blocking control in assays to test for specificity of this C19ORF28 antibody

Images

Immunohistochemical staining using C19ORF28 antibody (70R-6785)

C19ORF28 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of this gene remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using C19ORF28 antibody (70R-6785) | C19ORF28 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using C19ORF28 antibody (70R-6785) | C19ORF28 antibody (70R-6785) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors