C19ORF46 antibody (70R-6674)

Rabbit polyclonal C19ORF46 antibody raised against the N terminal Of C19Orf46

Synonyms Polyclonal C19ORF46 antibody, Anti-C19ORF46 antibody, Chromosome 19 ORF, Chromosome ORF 19 antibody, FLJ36445 antibody, Chromosome ORF-19 antibody, Chromosome ORF 19, Chromosome ORF-19
Specificity C19ORF46 antibody was raised against the N terminal Of C19Orf46
Cross Reactivity Human
Applications WB
Immunogen C19ORF46 antibody was raised using the N terminal Of C19Orf46 corresponding to a region with amino acids GEESTSPEQAQTLGQDSLGPPEHFQGGPRGNEPAAHPPRWSTPSSYEDPA
Assay Information C19ORF46 Blocking Peptide, catalog no. 33R-3224, is also available for use as a blocking control in assays to test for specificity of this C19ORF46 antibody

Images

Western Blot analysis using C19ORF46 antibody (70R-6674)

C19ORF46 antibody (70R-6674) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C19ORF46 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C19orf46 contributes to the establishment of secretory epithelial morphology by promoting kinesin-dependent apical migration of the centrosome and Golgi apparatus and basal localization of the nucleus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C19ORF46 antibody (70R-6674) | C19ORF46 antibody (70R-6674) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors