C1GALT1 antibody (70R-7429)

Rabbit polyclonal C1GALT1 antibody raised against the middle region of C1GALT1

Synonyms Polyclonal C1GALT1 antibody, Anti-C1GALT1 antibody, CGALT 1 antibody, CGALT-1 antibody, CGALT 1, Core 1 Synthase Glycoprotein-N-Acetylgalactosamine 3-Beta-Galactosyltransferase 1 antibody, C1GALT antibody, T-synthase antibody, CGALT-1, C1GALT
Specificity C1GALT1 antibody was raised against the middle region of C1GALT1
Cross Reactivity Human, Mouse
Applications WB
Immunogen C1GALT1 antibody was raised using the middle region of C1GALT1 corresponding to a region with amino acids NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
Assay Information C1GALT1 Blocking Peptide, catalog no. 33R-6911, is also available for use as a blocking control in assays to test for specificity of this C1GALT1 antibody

Images

Western Blot analysis using C1GALT1 antibody (70R-7429)

C1GALT1 antibody (70R-7429) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1GALT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The common core 1 O-glycan structure Gal-beta-1-3GalNAc-R is a precursor for many extended mucin-type O-glycan structures in animal cell surface and secreted glycoproteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C1GALT1 antibody (70R-7429) | C1GALT1 antibody (70R-7429) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors