C1ORF102 antibody (70R-3298)

Rabbit polyclonal C1ORF102 antibody raised against the N terminal Of C1Orf102

Synonyms Polyclonal C1ORF102 antibody, Anti-C1ORF102 antibody, Chromosome ORF-1 antibody, NOR1 antibody, Chromosome 1 ORF, Chromosome ORF 1 antibody, Chromosome ORF 1, MGC26685 antibody, Chromosome ORF-1, OSCP1 antibody
Specificity C1ORF102 antibody was raised against the N terminal Of C1Orf102
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen C1ORF102 antibody was raised using the N terminal Of C1Orf102 corresponding to a region with amino acids MSVRTLPLLFLNLGGEMLYILDQRLRAQNIPGDKARKDEWTEVDRKRVLN
Assay Information C1ORF102 Blocking Peptide, catalog no. 33R-6525, is also available for use as a blocking control in assays to test for specificity of this C1ORF102 antibody


Western Blot analysis using C1ORF102 antibody (70R-3298)

C1ORF102 antibody (70R-3298) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF102 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C1ORF102 may be involved in drug clearance in the placenta.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C1ORF102 antibody (70R-3298) | C1ORF102 antibody (70R-3298) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors