C1ORF116 antibody (70R-3844)

Rabbit polyclonal C1ORF116 antibody raised against the middle region of C1Orf116

Synonyms Polyclonal C1ORF116 antibody, Anti-C1ORF116 antibody, Chromosome ORF-1 antibody, Chromosome ORF 1, SARG antibody, Chromosome ORF 1 antibody, Chromosome ORF-1, MGC2742 antibody, Chromosome 1 ORF, FLJ36507 antibody, MGC4309 antibody, DKFZp666H2010 antibody
Specificity C1ORF116 antibody was raised against the middle region of C1Orf116
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C1ORF116 antibody was raised using the middle region of C1Orf116 corresponding to a region with amino acids SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDASPKTSTSLGK
Assay Information C1ORF116 Blocking Peptide, catalog no. 33R-8474, is also available for use as a blocking control in assays to test for specificity of this C1ORF116 antibody


Western Blot analysis using C1ORF116 antibody (70R-3844)

C1ORF116 antibody (70R-3844) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF116 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C1orf116 belongs to the SARG family. It is a putative androgen-specific receptor. It is highly expressed in prostate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C1ORF116 antibody (70R-3844) | C1ORF116 antibody (70R-3844) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors