C1ORF166 antibody (70R-5998)

Rabbit polyclonal C1ORF166 antibody raised against the middle region of C1Orf166

Synonyms Polyclonal C1ORF166 antibody, Anti-C1ORF166 antibody, FLJ12875 antibody, Chromosome ORF 1, Chromosome ORF 1 antibody, RP11-401M16.2 antibody, Chromosome ORF-1 antibody, Chromosome ORF-1, Chromosome 1 ORF
Specificity C1ORF166 antibody was raised against the middle region of C1Orf166
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C1ORF166 antibody was raised using the middle region of C1Orf166 corresponding to a region with amino acids GMQYYLSSQDFDSLLQRQESSVRLWKVLALVFGFATCATLFFILRKQYLQ
Assay Information C1ORF166 Blocking Peptide, catalog no. 33R-3439, is also available for use as a blocking control in assays to test for specificity of this C1ORF166 antibody


Western Blot analysis using C1ORF166 antibody (70R-5998)

C1ORF166 antibody (70R-5998) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF166 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C1orf166 encodes an ubiquitin-protein ligase that plays a role in the control of mitochondrial morphology. Promotes mitochondrial fragmentation and influences mitochondrial localization. Inhibits cell growth. When overexpressed, activates JNK through MAP3K7/TAK1 and induces caspase-dependent apoptosis. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C1ORF166 antibody (70R-5998) | C1ORF166 antibody (70R-5998) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors