C1ORF55 antibody (70R-3294)

Rabbit polyclonal C1ORF55 antibody raised against the C terminal Of C1Orf55

Synonyms Polyclonal C1ORF55 antibody, Anti-C1ORF55 antibody, RP4-671D7.1 antibody, Chromosome 1 ORF, Chromosome ORF 1, Chromosome ORF-1, Chromosome ORF 1 antibody, Chromosome ORF-1 antibody, FLJ35382 antibody, dJ671D7.1 antibody
Specificity C1ORF55 antibody was raised against the C terminal Of C1Orf55
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C1ORF55 antibody was raised using the C terminal Of C1Orf55 corresponding to a region with amino acids AFTSVAELELLGLEKLKCELMALGLKCGGTLQERAARLFSVRGLAKEQID
Assay Information C1ORF55 Blocking Peptide, catalog no. 33R-1180, is also available for use as a blocking control in assays to test for specificity of this C1ORF55 antibody

Images

Western Blot analysis using C1ORF55 antibody (70R-3294)

C1ORF55 antibody (70R-3294) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF55 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C1orf55 is phosphorylated upon DNA damage, probably by ATM or ATR. The exact function of C1orf55 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C1ORF55 antibody (70R-3294) | C1ORF55 antibody (70R-3294) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors