C1ORF93 antibody (70R-4161)

Rabbit polyclonal C1ORF93 antibody raised against the middle region of C1Orf93

Synonyms Polyclonal C1ORF93 antibody, Anti-C1ORF93 antibody, RP3-395M20.10 antibody, DKFZp547M123 antibody, Chromosome ORF 1, Chromosome ORF 1 antibody, Chromosome ORF-1, MGC26818 antibody, Chromosome 1 ORF, Chromosome ORF-1 antibody
Specificity C1ORF93 antibody was raised against the middle region of C1Orf93
Cross Reactivity Human
Applications WB
Immunogen C1ORF93 antibody was raised using the middle region of C1Orf93 corresponding to a region with amino acids RYNSLSILPAALGKPVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGD
Assay Information C1ORF93 Blocking Peptide, catalog no. 33R-8280, is also available for use as a blocking control in assays to test for specificity of this C1ORF93 antibody

Images

Western Blot analysis using C1ORF93 antibody (70R-4161)

C1ORF93 antibody (70R-4161) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1ORF93 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C1ORF93 antibody (70R-4161) | C1ORF93 antibody (70R-4161) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors