C1QB antibody (70R-5985)

Rabbit polyclonal C1QB antibody raised against the C terminal of C1QB

Synonyms Polyclonal C1QB antibody, Anti-C1QB antibody, Complement 1 Q SubB Chain antibody, Complement C-1, Complement C 1 antibody, Complement C-1 antibody, Complement C1, Complement C 1
Specificity C1QB antibody was raised against the C terminal of C1QB
Cross Reactivity Human
Applications IHC, WB
Immunogen C1QB antibody was raised using the C terminal of C1QB corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
Assay Information C1QB Blocking Peptide, catalog no. 33R-1631, is also available for use as a blocking control in assays to test for specificity of this C1QB antibody

Images

Immunohistochemical staining using C1QB antibody (70R-5985)

C1QB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1QB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using C1QB antibody (70R-5985) | C1QB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using C1QB antibody (70R-5985) | C1QB antibody (70R-5985) used at 0.5 ug/ml to detect target protein.
  • Immunohistochemical staining using C1QB antibody (70R-5985) | C1QB antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors