C1QB antibody (70R-5990)

Rabbit polyclonal C1QB antibody raised against the middle region of C1QB

Synonyms Polyclonal C1QB antibody, Anti-C1QB antibody, Complement 1 Q SubB Chain antibody, Complement C-1, Complement C1, Complement C-1 antibody, Complement C 1, Complement C 1 antibody
Specificity C1QB antibody was raised against the middle region of C1QB
Cross Reactivity Human
Applications WB
Immunogen C1QB antibody was raised using the middle region of C1QB corresponding to a region with amino acids PGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPR
Assay Information C1QB Blocking Peptide, catalog no. 33R-7122, is also available for use as a blocking control in assays to test for specificity of this C1QB antibody

Images

Western Blot analysis using C1QB antibody (70R-5990)

C1QB antibody (70R-5990) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1QB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C1q associates with the proenzymes C1r and C1s to yield C1, the first component of the serum complement system. The collagen-like regions of C1q interact with the Ca2+-dependent C1r2C1s2 proenzyme complex, and efficient activation of C1 takes place on interaction of the globular heads of C1q with the Fc regions of IgG or IgM antibody present in immune complexes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C1QB antibody (70R-5990) | C1QB antibody (70R-5990) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors