C1QTNF4 antibody (70R-5423)

Rabbit polyclonal C1QTNF4 antibody raised against the middle region of C1QTNF4

Synonyms Polyclonal C1QTNF4 antibody, Anti-C1QTNF4 antibody, ZACRP4 antibody, CQTNF-1, C1Q And Tumor Necrosis Factor Related Protein 4 antibody, C1QTNF, CTRP4 antibody, CQTNF-1 antibody, CQTNF 1, CQTNF 1 antibody
Specificity C1QTNF4 antibody was raised against the middle region of C1QTNF4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C1QTNF4 antibody was raised using the middle region of C1QTNF4 corresponding to a region with amino acids DEQRRPGARRAASQSAMLQLDYGDTVWLRLHGAPQYALGAPGATFSGYLV
Assay Information C1QTNF4 Blocking Peptide, catalog no. 33R-1918, is also available for use as a blocking control in assays to test for specificity of this C1QTNF4 antibody

Images

Western Blot analysis using C1QTNF4 antibody (70R-5423)

C1QTNF4 antibody (70R-5423) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C1QTNF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C1QTNF4 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C1QTNF4 antibody (70R-5423) | C1QTNF4 antibody (70R-5423) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors