C20orf132 antibody (70R-4048)

Rabbit polyclonal C20orf132 antibody raised against the middle region of C20orf132

Synonyms Polyclonal C20orf132 antibody, Anti-C20orf132 antibody, Chromosome 20 Open Reading Frame 132 antibody, Chromosome 20 ORF, DKFZp434N0426 antibody, dJ621N11.4 antibody, Chromosome ORF-20 antibody, FLJ36113 antibody, Chromosome ORF 20, Chromosome ORF-20, Chromosome ORF 20 antibody
Specificity C20orf132 antibody was raised against the middle region of C20orf132
Cross Reactivity Human
Applications WB
Immunogen C20orf132 antibody was raised using the middle region of C20orf132 corresponding to a region with amino acids PHLENLDTIIKLPLRFQRLGHLVALMALLCGDPQEKVAEEAAEGIHSLLH
Assay Information C20orf132 Blocking Peptide, catalog no. 33R-7146, is also available for use as a blocking control in assays to test for specificity of this C20orf132 antibody


Western Blot analysis using C20orf132 antibody (70R-4048)

C20orf132 antibody (70R-4048) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C20orf132 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 20 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C20orf132 antibody (70R-4048) | C20orf132 antibody (70R-4048) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors