C20ORF160 antibody (70R-4133)

Rabbit polyclonal C20ORF160 antibody raised against the N terminal Of C20Orf160

Synonyms Polyclonal C20ORF160 antibody, Anti-C20ORF160 antibody, dJ310O13.5 antibody, Chromosome ORF 20 antibody, Chromosome ORF 20, Chromosome ORF-20 antibody, Chromosome ORF-20, Chromosome 20 ORF, FLJ43600 antibody
Specificity C20ORF160 antibody was raised against the N terminal Of C20Orf160
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C20ORF160 antibody was raised using the N terminal Of C20Orf160 corresponding to a region with amino acids LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL
Assay Information C20ORF160 Blocking Peptide, catalog no. 33R-5492, is also available for use as a blocking control in assays to test for specificity of this C20ORF160 antibody

Images

Western Blot analysis using C20ORF160 antibody (70R-4133)

C20ORF160 antibody (70R-4133) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C20ORF160 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C20orf160 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C20ORF160 antibody (70R-4133) | C20ORF160 antibody (70R-4133) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors