C20ORF19 antibody (70R-4436)

Rabbit polyclonal C20ORF19 antibody raised against the C terminal Of C20Orf19

Synonyms Polyclonal C20ORF19 antibody, Anti-C20ORF19 antibody, MGC141930 antibody, Chromosome ORF 20, Chromosome ORF-20, DKFZP586H021 antibody, MGC102941 antibody, Chromosome 20 ORF, HT013 antibody, Chromosome ORF-20 antibody, Chromosome ORF 20 antibody
Specificity C20ORF19 antibody was raised against the C terminal Of C20Orf19
Cross Reactivity Human
Applications WB
Immunogen C20ORF19 antibody was raised using the C terminal Of C20Orf19 corresponding to a region with amino acids SRHENKKKPVINLKSNALWDESDDSNSEIEAALRPRNHNTDDSDDFYD
Assay Information C20ORF19 Blocking Peptide, catalog no. 33R-8753, is also available for use as a blocking control in assays to test for specificity of this C20ORF19 antibody


Western Blot analysis using C20ORF19 antibody (70R-4436)

C20ORF19 antibody (70R-4436) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 75 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C20ORF19 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C20orf19 encodes a centrosomal protein required for establishing a robust mitotic centrosome architecture that can endure theforces that converge on the centrosomes during spindle formation. Required for stabilizing the expanded pericentriolar material around the centriole.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C20ORF19 antibody (70R-4436) | C20ORF19 antibody (70R-4436) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors