C20ORF24 antibody (70R-1817)

Rabbit polyclonal C20ORF24 antibody raised against the N terminal Of C20Orf24

Synonyms Polyclonal C20ORF24 antibody, Anti-C20ORF24 antibody, Chromosome 20 ORF, RIP5 antibody, Chromosome ORF-20, Chromosome ORF 20 antibody, PNAS-11 antibody, Chromosome ORF 20, Chromosome ORF-20 antibody
Specificity C20ORF24 antibody was raised against the N terminal Of C20Orf24
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C20ORF24 antibody was raised using the N terminal Of C20Orf24 corresponding to a region with amino acids MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQ
Assay Information C20ORF24 Blocking Peptide, catalog no. 33R-6429, is also available for use as a blocking control in assays to test for specificity of this C20ORF24 antibody


Western Blot analysis using C20ORF24 antibody (70R-1817)

C20ORF24 antibody (70R-1817) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 15 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C20ORF24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 20 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C20ORF24 antibody (70R-1817) | C20ORF24 antibody (70R-1817) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors