C20ORF3 antibody (70R-1818)

Rabbit polyclonal C20ORF3 antibody raised against the C terminal Of C20Orf3

Synonyms Polyclonal C20ORF3 antibody, Anti-C20ORF3 antibody, APMAP antibody, Chromosome ORF-20 antibody, Chromosome ORF 20, Chromosome ORF-20, Chromosome ORF 20 antibody, BSCv antibody, Chromosome 20 ORF
Specificity C20ORF3 antibody was raised against the C terminal Of C20Orf3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C20ORF3 antibody was raised using the C terminal Of C20Orf3 corresponding to a region with amino acids QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL
Assay Information C20ORF3 Blocking Peptide, catalog no. 33R-7541, is also available for use as a blocking control in assays to test for specificity of this C20ORF3 antibody

Images

Western Blot analysis using C20ORF3 antibody (70R-1818)

C20ORF3 antibody (70R-1818) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of C20ORF3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C20orf3 may play a role in adipocyte differentiation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C20ORF3 antibody (70R-1818) | C20ORF3 antibody (70R-1818) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors