C20ORF30 antibody (70R-6822)

Rabbit polyclonal C20ORF30 antibody raised against the C terminal Of C20Orf30

Synonyms Polyclonal C20ORF30 antibody, Anti-C20ORF30 antibody, Chromosome ORF-20, Chromosome ORF 20, Chromosome ORF 20 antibody, Chromosome ORF-20 antibody, Chromosome 20 ORF, HSPC274 antibody, dJ1116H23.2.1 antibody
Specificity C20ORF30 antibody was raised against the C terminal Of C20Orf30
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C20ORF30 antibody was raised using the C terminal Of C20Orf30 corresponding to a region with amino acids KGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRGYSYDDIPDFDD
Assay Information C20ORF30 Blocking Peptide, catalog no. 33R-4391, is also available for use as a blocking control in assays to test for specificity of this C20ORF30 antibody

Images

Western Blot analysis using C20ORF30 antibody (70R-6822)

C20ORF30 antibody (70R-6822) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C20ORF30 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C20orf30 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C20ORF30 antibody (70R-6822) | C20ORF30 antibody (70R-6822) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors